Dataset Viewer
Auto-converted to Parquet Duplicate
ID
stringlengths
6
10
Text
stringlengths
102
32.8k
Protein
stringlengths
2
2k
Species
stringlengths
8
196
Family
stringlengths
9
181
A0A017SPL2
Belongs to the Tryptophan dimethylallyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as alkaloid metabolic process. It exhibits molecular functions including prenyltransferase activity.
MQPYHTLSRVLPFPDANQKAWWDKLGPMLLKAMQSQGYDTEAQYAQLGMVYKCVLPYLGEFPTVENDATRWKSFLCPYGIPIEPSLNISQGILRYAFEPIGPDVGTEKDPQNMNIIQDCLKGLTQHDDRIDTTLHAEFSSRLLLTEEESRQFATTGQFNFGPGQGMHGFAVDLKGSRPMFKGYFCAGIKSVVTGIPTGKLMLDAVREVDTEGRITQPLDKLEEYSANGIGKLMLCFMSVDMVNPHDARIKMYGLQQEVSREGIVDLWTLGGRVNTPTNQEGLELLLELWDLLQIPAGPRSVAISHCSVGQPPEYMLPTLV...
Aspergillus ruber (strain CBS 135680)
Tryptophan dimethylallyltransferase family
A0A023GPI8
Belongs to the Leguminous lectin family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It exhibits molecular functions including D-mannose binding, metal ion binding.
ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVGKRLSAVVSYPNGDSATVSYDVDLDNVLPEWVRVGLSATTGLYKETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGRDGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFDATFTFLIKSSDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN
Canavalia boliviana
Leguminous lectin family
A0A024BTN9
Belongs to the Flavin monoamine oxidase family, FIG1 subfamily. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as amino acid catabolic process, defense response to bacterium. It exhibits molecular functions incl...
SCADDRNPLEECFQETDYEEFLEIARNGLKATSNPKHVVIVGAGMSGLSAAYVLAGAGHQVTVLEASERAGGRVRTYRNDKEGWYANLGPMRLPEKHRIVREYITKFGLQLNEFSQENENAWYFIKNIRKRVGEVKKDPGLLQYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILDKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDNIFGYEKRFNEIVDGMDKLPTSMYQAIEEKVRFNARVIKIQQNDNEVTVTYQTSENEMSPVTADYVIVCTTSRAARRITFEPPLPPKKAHALRS...
Bothriechis schlegelii (Eyelash palm pitviper)
Flavin monoamine oxidase family, FIG1 subfamily
A0A024QYT3
Belongs to the Osteocalcin/matrix Gla protein family. The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It participates in biological processes such as osteoblast differentiation, biomineral tissue development, response to vitamin K, bone development, regula...
MKSLTLLTICAVLSVSLSMNDLALDVVLDPAPDPATEPAPAADSSASSSASSSSSSASDSSASASDSSDSDSSSASSSSSSSESASAEVTTEDPAAATEPEVVIMKRDLASVLLRRKRAAGQAAAAFTLTQVESLSEVCELNLACEHMAETAGIVAAYTAYYGPPPF
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Osteocalcin/matrix Gla protein family
A0A024RBG1
Belongs to the Nudix hydrolase family, DIPP subfamily. The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It participates in biological processes such as diphosphoinositol polyphosphate metabolic process, diadenosine pentaphosphate catabolic process, diadenos...
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Homo sapiens (Human)
Nudix hydrolase family, DIPP subfamily
A0A024SH20
Belongs to the Glycosyl hydrolase 5 (cellulase A) family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as cellulose catabolic process. It exhibits molecular functions including cellulase activity, cellulose bi...
MNKSVAPLLLAASILYGGAAAQQTVWGQCGGIGWSGPTNCAPGSACSTLNPYYAQCIPGATTITTSTRPPSGPTTTTRATSTSSSTPPTSSGVRFAGVNIAGFDFGCTTDGTCVTSKVYPPLKNFTGSNNYPDGIGQMQHFVNDDGMTIFRLPVGWQYLVNNNLGGNLDSTSISKYDQLVQGCLSLGAYCIVDIHNYARWNGGIIGQGGPTNAQFTSLWSQLASKYASQSRVWFGIMNEPHDVNINTWAATVQEVVTAIRNAGATSQFISLPGNDWQSAGAFISDGSAAALSQVTNPDGSTTNLIFDVHKYLDSDNSGTH...
Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) (Trichoderma reesei)
Glycosyl hydrolase 5 (cellulase A) family
A0A024SMV2
Belongs to the Gfo/Idh/MocA family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It exhibits molecular functions including nucleotide binding, D-xylose 1-dehydrogenase (NADP+) activity.
MASGNPYTLKWGIMATGGIAETFCKDLLCNPAIRGADDVRHEIVAVASSSSSKRAEEFLQRIDGAFDAKTYGSYPELVADPNVDIVYVATPHSHHFQNTMLALEAGKNVLCEKAFTVTAAQARKLVETAKAKKLFLMEAVWTRYFPLSIKIRELIAAGEIGTVFRTIADLSINANSEQGQALKFADSHRMVNPDLAGGATLDLGVYPLTWVFQTLYHLQPEEDKEAPTVVASSNKYTTGADENTAIICSFPRHNSIGIASTTMRADTDPEKDTIPAVRIQGSKGEIQVFFPTYRPLKYKVVKTNGEAQTVDCPIPGDPAR...
Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) (Trichoderma reesei)
Gfo/Idh/MocA family
A0A024SNB7
Belongs to the Glycosyl hydrolase 7 (cellulase C) family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as cellulose catabolic process. It exhibits molecular functions including cellulase activity, cellulose bi...
MAPSVTLPLTTAILAIARLVAAQQPGTSTPEVHPKLTTYKCTKSGGCVAQDTSVVLDWNYRWMHDANYNSCTVNGGVNTTLCPDEATCGKNCFIEGVDYAASGVTTSGSSLTMNQYMPSSSGGYSSVSPRLYLLDSDGEYVMLKLNGQELSFDVDLSALPCGENGSLYLSQMDENGGANQYNTAGANYGSGYCDAQCPVQTWRNGTLNTSHQGFCCNEMDILEGNSRANALTPHSCTATACDSAGCGFNPYGSGYKSYYGPGDTVDTSKTFTIITQFNTDNGSPSGNLVSITRKYQQNGVDIPSAQPGGDTISSCPSASA...
Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) (Trichoderma reesei)
Glycosyl hydrolase 7 (cellulase C) family
A0A031WDE4
Belongs to the Glycyl radical enzyme (GRE) family, HYPD subfamily. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as proline salvage. It exhibits molecular functions including carbon-oxygen lyase activity. ...
MARGTFERTKKLREESINAEPHISIERAVLMTEAYKKYEGSVEIPVLRALSFKHYIENRTLSINDGELIVGEKGDSPNGAPTYPEICCHTMEDLEVMHNRDIINFSVSEEARKIHKEEIIPFWKKRQTRDKIINAMTPEWLAAYEAGMFTEFMEQRAPGHTVCGDTIYKKGFLDLKKDIEARLKELDFLNDLDAYNKKADLEAMAIACDAMVILGKRYAEKARQMAEEETDEAKKKDLLLIAETCDVVPAHKPETYHQAIQMYWFVHIGVTTELNIWDAFTPGRLDQHLNPFYERDVENGILDRDRAQELLECLWVKFNN...
Clostridioides difficile (Peptoclostridium difficile)
Glycyl radical enzyme (GRE) family, HYPD subfamily
A0A059J0G5
Belongs to the ABC transporter superfamily, ABCG family, PDR (TC 3.A.1.205) subfamily. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It exhibits molecular functions including ATP binding, ATP hydrolysis activity, ABC-type transporter activity. It is loca...
MASQPPQPPSGQPDTQYEEYQSEVITETTNRPTPAADVYEITPTNDVMDDRYEHEHDDYESGAMYETVRTWSPQSRPELVRIASVFSRIDSHPDVAPTTEDGGQLNRRDTLAGVKIGDPVLDPTKPEFDFYKWARMFTHVMEKEGIKRNRTGVMFRNLTVLGSGSAVQYQDTFLSPFAAPFRPGELCGKGRNPEKVILHDFNGAIREGELLMVLGRPGSGCSTFLKAICGELHGLQKKKESIIHYNGVSQHTFKKELRGEAVYSAEDEHHFPHLTVGQTLEFAAAARTPSKRVLGLSRKDFSTHLARVMMSVFGLSHTYN...
Trichophyton interdigitale (strain MR816)
ABC transporter superfamily, ABCG family, PDR (TC 3.A.1.205) subfamily
A0A059JJ46
Belongs to the ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as oligopeptide export from mitochondrion. It exhi...
MVEVSEKPNTQDDGVSKQENRNPASSSSSTSDKEKVAKKGNSDATKSSTPEDLDAQLAHLPEHEREILKQQLFIPDAKATYGTLFRYATRNDMIFLAIVSLASIAAGAALPLFTVLFGSLAGTFRDIALHRITYDEFNSILTRNSLYFVYLGIAQFILLYVSTVGFIYVGEHITQKIRAKYLHAILRQNIGFFDKLGAGEVTTRITADTNLIQDGISEKVGLTLTALSTFFSAFIIGYVRYWKLALICSSTIVAMILVMGGISRFVVKSGRMTLVSYGEGGTVAEEVISSIRNATAFGTQEKLARQYEVHLKEARKWGRR...
Trichophyton interdigitale (strain MR816)
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
A0A059T2H4
Belongs to the Spider toxin CSTX family, Double-CSTX subfamily. The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It exhibits molecular functions including toxin activity. It is located in cellular components such as extracellular region.
MKFSLFFGVLFLAILHSCLSESEKDLTDEDHFRSSDSFLSEIQEESRGKKCIERNKECTNDRHGCCRGKIFKDKCECVGSGGKERCVCKQKKWAKIIESYIGDIPTLPKPEDDKCVPKHEDCSERKNDCCKSGLFTLKCKCYDMQDDEDGKKTELCGCVQPFEHKAIEQALRFGKWMVG
Cheiracanthium punctorium (Yellow sac spider) (Aranea punctoria)
Spider toxin CSTX family, Double-CSTX subfamily
A0A059WGE7
Belongs to the Rifampicin phosphotransferase family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as response to antibiotic. It exhibits molecular functions including ATP binding, kinase activity.
MSGRLVVDLQDVDAAGLAEVGGKGAHLGELSRIDGVRVPSGFCVTTHAFRRIMAEAPESGELLDRLSRVDEGDQEAVRSLAARLRQVVGATPLPDEVAAAVTGALARHGERSAYAVRSSATAEDLPTASFAGQQDTYLNVVGTEEILRHVSRCWASLFTERAVTYRGRQGVDHRTVHMGVVVQRMVVPRASGILFTADPVTGDRRTATVDAGFGLGEALVSGLVDPDVLTVRHGEVVARTIAAKRRALHAVQGGGTRETPIEERRQREPVLTDDQAVELVALGRRIEAHFGSPQDIEWCLDDDGFHIVQSRPITTLFPVP...
Streptomyces sp
Rifampicin phosphotransferase family
A0A059WLZ7
The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as catabolic process. It exhibits molecular functions including oxidoreductase activity, metal ion binding, 2 iron, 2 sulfur cluster binding.
MFLQNAWYAVAWCDEVTDGIVTRKVLGRELALFRDGEGQPRAILNRCPHRFAPLSLGKRIGDAIQCPYHGLHFGPDGRCVHNPHGDGVVPDVATPTFPARERHKLIWAWMGDPALATDDIAGGEYGYLDDVELDLLPRGHLHLDCDYRLVIDNLMDPAHVAVLHDSALASEALIRAVPRVWREEDVIRVESWAPDSKPSFLFGAWLGNHDDPVDHWVASRWQAAGLLSVEGGVVAVGGDREDGLRVRGAHMITPETETSAHYFWAVVRNFREDDAEQSEQIRATTAAIFTGEDKWMLEAIERSMDGEEFWSLRPAILGTD...
Rhizorhabdus wittichii (strain DC-6 / KACC 16600) (Sphingomonas wittichii)
null
A0A059ZRB8
The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It exhibits molecular functions including metal ion binding. It is located in cellular components such as extracellular region.
MKISQLFLGLVACSTAFAYAGIDGISSNESNIKIGAAANASHPGGVAAVSVQAAGAPYNAFTGFSSLKGLAQAFAAQGTSNTNVTVGSKTFNISHIPVSAMPPSHSALGNFNFGQVGTQEVYFGEWWKAGDTPASASHTVYYAGDNTNTTVPTAGTATYTVAGINGSASNLLSGTFTANYGAGTLEGTLTGTGTAVSSLSLDGVAFNPGTAAFAGLATANGTAGVDNSGVVQGQFFGANASALAGIAQFDNVSYNTAFGGAKN
Acinetobacter baumannii
null
A0A060D764
Belongs to the GRF family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as DNA-templated transcription, positive regulation of DNA-templated transcription, leaf development. It exhibits molecular functions inc...
MAMPYASLSPAGAADHRSSTATASLVPFCRSTPLSAGGGLGEEDAQASARWPAARPVVPFTPAQYQELEQQALIYKYLVAGVPVPPDLVVPIRRGLDSLATRFYGQPTLGYGPYLGRKLDPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVETQLAPQSQPPAAAAVSAAPPLAAAAAATTNGSGFQNHSLYPAIAGSTGGGGGVGGSGNISSPFSSSMGGSSQLHMDSAASYSYAALGGGTAKDLRYNAYGIRSLADEHNQLIAEAIDSSIESQWRLPSSSFPLSSYPHLGALGDLGGQNSTVSSLPK...
Zea mays (Maize)
GRF family
A0A060KY90
The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as regulation of DNA-templated transcription, trichome morphogenesis, positive regulation of DNA-templated transcription. It exhibits molecular functions inclu...
MTDYRLWSNTNTTNTCDDTMMMDSFLSSDPSSFWPASTPNRPTPVNGVGETMPFFNQESLQQRLQALIDGARESWAYAIFWQSSVVDFASQTVLGWGDGYYKGEEDKNKRRGSSSSAANFVAEQEHRKKVLRELNSLISGVQASAGNGTDDAVDEEVTDTEWFFLISMTQSFVNGNGLPGLAMYSSSPIWVTGTEKLAASQCERARQAQGFGLQTIVCIPSANGVVELGSTELIFQSSDLMNKVKYLFNFNIDMGSVTGSGSGSGSCAVHPEPDPSALWLTDPSSSVVEPKDSLIHSSSRDVQLVYGNENSENQQQHCQG...
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
null
A0A060LAL9
Belongs to the Caleosin family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as negative regulation of lipid storage. It exhibits molecular functions including monooxygenase activity, calcium ion binding, hem...
MASNESLQTTAAMAPVTIERRVNPNLDDELPKPFLPRALVAVDTEHPSGTPGHQHGDMSVLQQHVAFSNRNNDGIVYPWETFLGFRAVGFNIIISFFGCLIINIFLSYPTLPGWIPSPFFPIYIDRIHRAKHGSDSEVYDTEGRFVPAKFEEIFTKNAKTHPDKLSFSELWNLTEHNRNALDPLGWIAAKLEWFLLYSLAKDPHGFVPKEAARGVFDGSLFEFCEKSRKVKQATVKSLTFKI
Pinus massoniana (Chinese red pine)
Caleosin family
A0A060S684
Belongs to the Type-B carboxylesterase/lipase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It exhibits molecular functions including chlorogenate hydrolase activity. It is located in cellular components such as extracellular region.
MRLPNLTLLVWAATSVGLVSALPQVSYKADATASAPTVKLHQGTVRGLADDNYGLEQFFGIPYAKPPVGSLRFAKPQPLGPASSHKTVIDATRFGDICMQTVAPSPLYNMSEDCLNLNVVRPKGTTAKDKLPVLVWIYGGAFRQGSTPIYNASELVQKSVEIGKPIVFVAISYRVGPFGFIGGSEIADSDSATSNAGLYDQRLGLKWIRHNIGKFGGDKNRVTLFGQSAGAMSIALQNFAYDGNNHGLWHAAIMNSGGIAPGPLLTPKHPTVEQSFKRLANGVGCTGGSLLRCLRKANASEVQTVASNLTAQAGGTFPIP...
Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)
Type-B carboxylesterase/lipase family
A0A060X6Z0
Belongs to the Biopterin-dependent aromatic amino acid hydroxylase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as dopamine biosynthetic process from tyrosine. It exhibits molecular functions including...
MPISSSSSSSTKSMRRAASELERSDSVTSPRFIGRRQSLIEDARKEREAAAAAAEAAEATEQIVFEEEDGKALLNLFFTLRSSKTPALSRSLKVFETFEAKIHHLETRPCRKPRDSLEGLEYFVRCEVHLSDVSTLISSIKRIAEDVKTTKEVKFHWFPKKISELDRCHHLITKFDPDLDQEHPGFTDPVYRQRRKMIGDIAFRYKQGEPIPRVEYTEEEIGTWREVYSTLRDLYTTHACSEHLEAFNLLERHCGYSPENIPQLEDVSRFLRERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDC...
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Biopterin-dependent aromatic amino acid hydroxylase family
A0A061AE05
Belongs to the APS kinase family; Sulfate adenylyltransferase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as sulfate assimilation, 3'-phosphoadenosine 5'-phosphosulfate biosynthetic process. It e...
MLTPRDENNEGDAMPMLKKPRYSSLSGQSTNITYQEHTISREERAAAVGRHEGFRGCTIWFTGLSGAGKTTISFALERTLNKLGIPCYGLDGDNIRHGLCKNLGFSKEDRQENIRRVAEVAKLFADSGMICLAAFISPFQEDRLDARKIHESENVKFIEVHVSTTLEVCEQRDPKPSELYKKARAGQILGFTGIDSAYEPPENAEIILDAGKDGVQQCVQKVLDHLESKGLLPEQIPDVPAVRELFVSDDLTVAELLKESQNLPTVELTKVDLQWLQVLAEGWATPLSGFMRERQYLQSMHFGQLLDLKHKVAFVGEKSD...
Caenorhabditis elegans
APS kinase family; Sulfate adenylyltransferase family
A0A061B0Q2
Belongs to the AB hydrolase superfamily. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It exhibits molecular functions including acetyl-CoA hydrolase activity, transferase activity, carboxylic ester hydrolase activity. It is located in cellular components...
MFKPTRVLKSSQPILNSLPHAETVKMAYDLHLPKKTLHQNMNITSDEPIVFVHGIFGSKKSYATDSKLIANGTHSPVYTIDLRNHGETGHAQPFNYDTLVQDIKEFCSTHNLSNIKLVGYSLGAKVSMLAALRLPELVKSAVIIDNAPIKQPYIESYMKQYIKSMLHVDDAKISTTDKDWKRKASEAMKRYMPNATVRKNLLVNLVNKKPEGFESPAIDFENGNIQFLNPIKHMEEMAVKDVSDWPVESTEGLKFDGPVKFIRGLKSPFISPEGFKKINEHFPKNEFYDVNSAHDILDQRPSEYVKVICDFFNLQRYNSA...
Cyberlindnera fabianii (Yeast) (Hansenula fabianii)
AB hydrolase superfamily
A0A061IR73
Belongs to the AAA ATPase family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as protein targeting to peroxisome, protein import into peroxisome matrix, protein import into peroxisome matrix, translocation, ...
MALAVLRVLDPFPAETPPLAVLLPPGGPWPATGLGLVLALRPASESPAGPALLVAALEGPGSQNGQRGPGPPQLLVSRALLRLLALGPGARVRARPVRRPPALGWALLGSAPGPGPGPRVGPLLVRRGESLPVPGSRVLETRPALQGLLGPGTRLAVTELRGRAKLGPESTQHSRLPPPPVASSFAVSHAVRQLKGVLGGTGDALGVTRSCLRGLGLFQGEWVWVARVGEFPNTSQPHLAKVQLLEPRWDLSERLGPSSGQLGEPLADGLVFVPATLAFNLGCDPLEVGELRIQRYLEGSIIPEDRGSCSLMSGPPFARE...
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
AAA ATPase family
A0A067MTM1
Belongs to the NRP synthetase family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as fatty acid biosynthetic process, enterobactin biosynthetic process, amino acid activation for nonribosomal peptide biosynt...
MALFHNLEPKRSIDFMSGARTSSGSPSVSYSNSLPSPHTALVAPLSKMQRALWFDYISAPESTMYNLTLKFKLDQESEEYDGSISAILRAIDFLTKRHGMLRSTFHNSSNPSQPPYFAEIDSRHAHPTTHIVSSSEQLKRAALRGFDLSVDGPIRWIVFTNVKSNELYAVAHHIAVDGSSMSQLSKEIITLLTHYKHQSAEMLAPTTTSNYGLYCLAQDSYTHQESYKKALHFWSSQIAGTLPMEWNSSMLRTNPARLTQTTSQLDHRVCSTWLSLTPQELKAWGNLYKTSWFRVATALIGLLCAKHSKHKFRTDQSLLV...
Botryobasidium botryosum (strain FD-172 SS1)
NRP synthetase family
A0A067N4H9
Belongs to the Fungal hydrophobin family. The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It exhibits molecular functions including structural constituent of cell wall. It is located in cellular components such as extracellular region, fungal-type cell wal...
MFSRVMFCTFLILPLLAAATAIPRTDTPSCSTGSLQCCSSVQKASDPLVGIIVALLGIVLGPLDLNVGLTCSPITVIGVGGTSCTQQTVCCTGNNFDGLIVAGCSPINIGL
Pleurotus ostreatus (strain PC15) (Oyster mushroom)
Fungal hydrophobin family
A0A067N648
Belongs to the Fungal hydrophobin family. The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It exhibits molecular functions including structural constituent of cell wall. It is located in cellular components such as extracellular region, fungal-type cell wal...
MFFQTTIVAALASLAVATPLALRTDSRCNTESVKCCNKSEDAETFKKSASAALIPIKIGDITGEVYSECSPIVGLIGGSSCSAQTVCCDNAKFNGLVNIGCTPINVAL
Pleurotus ostreatus (strain PC15) (Oyster mushroom)
Fungal hydrophobin family
A0A067XMV4
Belongs to the Flavin-dependent halogenase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as secondary metabolite biosynthetic process. It exhibits molecular functions including monooxygenase activi...
MSVPAQTSVLIVGGGPAGSYAATVLAREGVDVVLLEAEKFPRYHIGESMLASIRFFLRFVELEEEFDRHGFEKKYGATFKITEKNPAYTDFAASLGEGGYSWNVVRSESDEIIFRYAGKCGAKTFDGTKVESLTFEPYPHEGFDESVHLANPGRPVSANWSRKDGSSGVIKFDYIIDGSGRNGLISTKYLKNRSFNQGLKNIANWTYWKGAKRFNVGEKNENSPLFEALKDGSGWVWAIPLHNDTISVGVVARQDAFFEKKKESGLSGEAFYKEYLKLAPQIKNELLRDATIVSDIKQATDWSYSASAYAGPNFRLIGDA...
Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Flavin-dependent halogenase family
A0A067XNI2
The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as fatty acid biosynthetic process, secondary metabolite biosynthetic process. It exhibits molecular functions including fatty acid synthase activity, 3-oxoacyl-[a...
MSDNSGSGTSPWGSLNTPVGPPKVTLAYFSNEFPPDDLNFIVRKLFDRTSKGPFCSIDGVLLCAIQFANLIGHYETTDHLFPFGSSIASVAGLGIGLVAAAAVSVTPSLADLPVAGAEAVRIAFRLGVLVDGVSQNLQPRDRSTTGTPDSWAYVIPDVSPEVVQKELDEIHSREKTPIPSKIFVSALSRTSVTISGPPARLRSLFRLSDFFRDRKFVALPVYGGLCHAGHIYEQRHVQEVVEKSVLDETHVRYSPSVRLFSTSTGKPFLSTSVTNLFEQVVGEILTQKIQWDKVVKGVLERIQELSATEVEVLVFRDSLP...
Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
null
A0A067Z9B6
Belongs to the Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family, COMT subfamily. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as terpenoid biosynthetic proc...
MADIAEQLIEKLQTLETSIFEGQDATRQKLALAARKLFHTLETKEEKTMRLAIEEPVMFSVLQALIDTGLFEGWAAAGGGERDVTELAKLSKRDVEPELLRHQLRLMAANHIILETANDRYAPTPYALAIGDKSTKVAPALRIRTDHVAPCAMHWPDFLAKTNYRKPRDDKASCYIDTFPEKKSFFERCSANPVHQESFSSFMDVWAKGKRPWPEFYDTQALLDGADLSNGSPFVVDVGGHHGIDLMRVAEKHPDLPAGSLVLEDLPDVVGAVHLTTDKIRTVAHDLFEEGVEQPIKGARAYFMHAVLHDWSDETSVKIL...
Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)
Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family, COMT subfamily
A0A068B0Z6
Belongs to the Conotoxin A superfamily. The protein length falls within the range of 31–100 amino acids, belonging to the category of Small proteins. It exhibits molecular functions including calcium channel regulator activity, acetylcholine receptor inhibitor activity, toxin activity. It is located in cellular compone...
FDGRNAAPSDKASDLISLAVRGCCSHPACSGNNPYFCGGKR
Conus litteratus (Lettered cone)
Conotoxin A superfamily
A0A068BGA5
Belongs to the Plant acyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as alcohol metabolic process, response to ethylene, fruit ripening, climacteric. It exhibits molecular functions includ...
MASFPPSLVFTVRRKEPILVLPSKPTPRELKQLSDIDDQEGLRFQVPVIMFYKRKLSTEGEDPVKVIREALAEALAFYYPFAGRLIEGPNRKLMVDCTSEGVLFIEADADIELNQLIGDTIDPGTYLDELLHDVPGSEGILGCPLLLIQVTRFRCGGWAFAIRLNHTMSDTLGLVQFLTTIAEFTRGAEGAPSVPPVWQREFLAARQPPFIPFQHHEYEQVIDTTPDDNKKSMTHKSFFFGPKEIRAIRSHLPLHHRSTSSTFDVLTACLWRCRTCALVLDPKKTVRISCAASGRGKHDLHVPRGYYGNVSAFPATVLRA...
Actinidia deliciosa (Kiwi)
Plant acyltransferase family
A0A068BIF1
Belongs to the Plant acyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as alcohol metabolic process, response to ethylene, fruit ripening, climacteric. It exhibits molecular functions includ...
MASSVRLVKKPVLVAPVDPTPSTVLSLSSLDSQLFLRFPIEYLLVYASPHGVDRAVTAARVKAALARSLVPYYPLAGRVKTRPDSTGLDVVCQAQGAGLLEAVSDYTASDFQRAPRSVTEWRKLLLVEVFKVVPPLVVQLTWLSDGCVALGVGFSHCVIDGIGSSEFLNLFAELATGRARLSEFQPKPVWDRHLLNSAGRTNLGTHPEFGRVPDLSGFVTRFTQERLSPTSITFDKTWLKELKNIAMSTSQPGEFPYTSFEVLSGHIWRSWARSLNLPAKQVLKLLFSINIRNRVKPSLPAGYYGNAFVLGCAQTSVKDL...
Actinidia eriantha (Velvet vine) (Actinidia fulvicoma var. lanata)
Plant acyltransferase family
A0A068CNX1
Belongs to the Peptidase C1 family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as proteolysis, phenylpropanoid biosynthetic process. It exhibits molecular functions including cysteine-type peptidase activity...
MARLLLLLVGVLIACAAGARAGSEFLAEDNPIRQVVDGMHELESSILKAVGNSRRAFSFARFAHRYGKSYESSEEIQKRFQVYSENLRMIRSHNKKGLSYSMGVNEFSDLTWDEFKKHRLGAAQNCSATRRGNHKLTSAILPDSKDWRESGIVSPVKSQGSCGSCWTFSSTGALEAAYAQAFGKGISLSEQQLVDCAGAFNNFGCNGGLPSQAFEYIKYNGGLMTEEAYPYTGHDGECKYSSENAAVQVLDSVNITLGAEDELKHAVALVRPVSVAFEVVDGFRSYNGGVYTSTTCGSDPMDVNHAVLAVGYGVEGGVPY...
Glechoma hederacea (Ground-ivy)
Peptidase C1 family
A0A068FIK2
Belongs to the TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, KIN-4 subfamily. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as microtubule-based movement, mitotic spindle organization, spindl...
MEVGGGSEECCVKVAVHVRPLIGDEKVQGCKDCVTVIPGKPQVQIGTHSFTFDHVYGSTSSPSWMFEECIVPLVDGLFQGYNATVLAYGQTGSGKTYTMGTGFKGGSQTGIIPQVMNALFSKIENLKHQIEFQLHVSFIEILKEEVRDLLDPTFLNKSDTASANTGKVNVPGKPPIQIRESSDGVITLAGSTEVSVSTLKEMGACLEQGSLSRATGSTNMNNQSSRSHAIFTITLEQMRKLNPVSGDGNPNDSMSEEYLCAKLHLVDLAGSERAKRTGSDGMRFKEGVHINKGLLALGNVISALGDEKKRKEGVHVPYRD...
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, KIN-4 subfamily
A0A068Q609
Belongs to the Cytochrome P450 family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It exhibits molecular functions including monooxygenase activity, iron ion binding, oxidoreductase activity, acting on paired donors, with incorporation or reduction...
MALLTLFNQIWQEGQLQSSTSSFNIFLVPILCLSIFILFSLTRSSSPSEKNRKLKLPPSPPRLPWIGNLHQLGSFPHRSLRALSKKYGDVMFMHFGKVPTLIVSSAEMAKDVMKTQDIVFCSRPQTTAPSILFYDGHDIAFAPYGEYWRQVRRICVLELLSLKRVHQFQYARVEEVAELVSKIRKASASANGAPINLGELLVSTSNNIICRCILGQKFEDKEDNWFGETTKELMTQVMSFSFGDFFPSLKWIDRARGYLAYLKSIWLEFDKFFDKLIDEHKAAQKEGKPRKKDIVDILLDVQNDGSLDFELTTSNVKAIL...
Prunus mume (Japanese apricot) (Armeniaca mume)
Cytochrome P450 family
A0A069CUU9
Belongs to the Peptidase M27 family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as proteolysis. It exhibits molecular functions including metalloendopeptidase activity, metal ion binding.
MDVLEMFDVNYESPILESFDSTTQSLNDVHVFMSRIQMSAYDADGEGRIEYRNLKLYEISSGIFISTDRLDTGASGVEDDHEMVDYYSSARLTREFLGESLDSQKSDYFEGIKKVFSFYKNKCNESRYIKEFFEEIQFRNICGFPKQAGTSSTDIFDQFNSVDVLLQDPVTSVWNKKVGSKKANIVIIPPATNLPITEACATAGFQPEGFPKLGSGSFFTVQFDPFFSTRFKAHETDDVALLDPTLTLLHEMTHGLHFQKGIANPVNRSGETPAWATTWGRVTGDNDAFKETPMEELLTFNKHTIDDDIEISDHLKSTYI...
Weissella oryzae (strain DSM 25784 / JCM 18191 / LMG 30913 / SG25)
Peptidase M27 family
A0A072TH68
Belongs to the Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as response to symbiotic fungus, arbuscular mycorrhizal association. It exhibits mo...
MSTRSLTIFILAHVWLLMATTSIAQFVIDTSGEPVEDDEEYFIRPAITGNGGGSTLVTGNGPCPLHVGLDNTEGTLGVAVKFTPFAPQHDDDDVRLNRDLRVTFLTSTSCGQSTDWRLGEKDATSGRRLIVTGRDNGAGSQGNFFRIVQTQTGGTYNIQWCPTEACPSCKVQCGTVGVIRENGKNLLALDGDALPVVFQKE
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family
A0A072TK64
Belongs to the Plant globin family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as response to nitric oxide. It exhibits molecular functions including oxygen carrier activity, oxidoreductase activity, oxygen ...
MEENKKTMEKSVGFTEEQDALVVKSWNAMKKNSGDLSLKFFKKILEIAPPAKQMFSFLKDSNVPLEHNPKLKPHAMSVFLMTCESAVQLRKAGKVTVRESNLKKLGATHFKTGVQDEHFEVTKQALLETIEEAIPEMWYPAMKNAWAEAHDRLANAIKAEMKEAHDQLDSANLIINMEENTGSCFTEEQEALVVKSWNAIKNNSEDLSLKFFKRIFEIAPPAKQLFSFLRDSNVPLEQNPKLKPHAMSVFLMTCESAVQLRKAGKVTVSESNLKKLGATHFKSGVKDEHFEVTKQVLLETIKEALPEMWSPAMENAWGEA...
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Plant globin family
A0A072UTP9
Belongs to the Peptidase C1 family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as immune response, proteolysis involved in protein catabolic process, positive regulation of apoptotic signaling pathway. It ex...
MAQWTLLIVFFCVATAAAGLSFHDSNPIRMVSDMEEQLLQVIGESRHAVSFARFANRYGKRYDTVDEMKRRFKIFSENLQLIKSTNKKRLGYTLGVNHFADWTWEEFRSHRLGAAQNCSATLKGNHRITDVVLPAEKDWRKEGIVSEVKDQGHCGSCWTFSTTGALESAYAQAFGKNISLSEQQLVDCAGAYNNFGCNGGLPSQAFEYIKYNGGLETEEAYPYTGQNGLCKFTSENVAVQVLGSVNITLGAEDELKHAVAFARPVSVAFQVVDDFRLYKKGVYTSTTCGSTPMDVNHAVLAVGYGIEDGVPYWLIKNSWG...
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Peptidase C1 family
A0A072VEP0
Belongs to the Glycosyl hydrolase 18 family, Chitinase class V subfamily. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as polysaccharide catabolic process, chitin catabolic process, defense response to fungus....
MAVQKIIITPILVFLVTIFFNVSSSSSSNNSQYQFLNHGVRSAYWPAGDDFSPSLIDTNYFTHILLAFIQPEPISFKLEITKSGIKWGQNFIKALRHRSPPVKTLLSIGGGGSNSTLFSEIASTKQNREIFINSTIEVARKYRFDGVDLDWEFPETQQDMFNLGLLYEEWYNALFAEAKVRRKPRLLLTSAVYYNSTVRLIGKHGPRSYPTQAINKYLDWASPMCFDYHGTWDNNTDFNAALYDSKSEISTNFGLHSWIKSGVRPEKLVMGLALYGRAWELKDPNVNGVGAEAVGPATDTDGSMNYNEILKFNKQSGANV...
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Glycosyl hydrolase 18 family, Chitinase class V subfamily
A0A072VMJ3
Belongs to the Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It exhibits molecular functions including voltage-gated potassium channel activity, transmembrane transporter binding. It is loca...
MGFDNPRSERFEDDPEISKIPTTSGVKVKYHIDGTQIPEQSSKKSRKNETRNKFLKTRVLSRVFSEDYERVKKRVLVLDPRGQLIHRWNKIFLVACLVSLFVDPLFFYLPVVREEVCIDIGKTLEVILTVVRSFGDLFYIVQICMKFRTAYVAPSSKVFGRGELVLTYSKIALRYFSKGFWLDFIAALPLPQVLIWIIIPTLRGSTMANTKNVLRFFIIFQYIPRLYLIFPLSSQIVKATGVVTETAWAGAAYNLMLYMLASHILGACWYLLSIERQEACWKSVCNMEKSNCQYGFFNCHSIKDAPRVAWFIASNVTNLC...
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
A0A072VPZ8
Belongs to the Zinc-containing alcohol dehydrogenase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as lignin biosynthetic process. It exhibits molecular functions including zinc ion binding, cinnamyl-al...
MGSIEVAERTTVGLAAKDPSGILTPYTYTLRNTGPDDVYIKIHYCGVCHSDLHQIKNDLGMSNYPMVPGHEVVGEVLEVGSNVTRFKVGEIVGVGLLVGCCKSCRACDSEIEQYCNKKIWSYNDVYTDGKITQGGFAESTVVEQKFVVKIPEGLAPEQVAPLLCAGVTVYSPLSHFGLKTPGLRGGILGLGGVGHMGVKVAKAFGHHVTVISSSDKKKKEALEDLGADSYLVSSDTVGMQEAADSLDYIIDTVPVGHPLEPYLSLLKIDGKLILMGVINTPLQFVTPMVMLGRKSITGSFVGSVKETEEMLEFWKEKGLS...
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Zinc-containing alcohol dehydrogenase family
A0A075B6J9
The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It participates in biological processes such as adaptive immune response, immune response. It is located in cellular components such as extracellular region, plasma membrane, immunoglobulin complex. Immune re...
MAWALLLLTLLTQGTGSWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF
Homo sapiens (Human)
null
A0A075B6N1
The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It participates in biological processes such as adaptive immune response, cell surface receptor signaling pathway. It is located in cellular components such as plasma membrane, alpha-beta T cell receptor comp...
MSNQVLCCVVLCLLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Homo sapiens (Human)
null
A0A075D654
Belongs to the Class I-like SAM-binding methyltransferase superfamily, gTMT family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as alkaloid metabolic process, methylation. It exhibits molecular functions inc...
MAENQEALAEFYDKGVGVWDNLSREHMHFGYYAPGATATIGGHRASLVRLIDEALCFAEFPDDPEKKPRNMLDVGCGIGGTCLHVAKKYDIQCKGINISPEQVKIAQGLAAAQGLESKVSFDVGDALDMPYPDGAFDLVLSIHCIEHLQDKEKFIREMVRVAASGATIIILSHVHRDLSPSEQSLKPQEERVLRKIGSSVQAWFCPLSNYVSLLAPLPVEVIKIADWSRNIDPSSRLMLKVAFSVKGIVSNLMKGVQGWTAIKNVLPMKLLHKALHDGLVKFVVLTCRKSN
Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum)
Class I-like SAM-binding methyltransferase superfamily, gTMT family
A0A075D6M1
Belongs to the Class I-like SAM-binding methyltransferase superfamily, gTMT family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as alkaloid metabolic process, methylation. It exhibits molecular functions inc...
MAEKQQAVTEFYNNTSPRGAWEFLLGDHLHEGFYDPGTTATISGSQAAAARMIDEALRFANIYDDPSKKPKNMLDIGCGVGGTCVHVAKQYGIQCKGITLSPEEVKCAQGIAKAQGLEEKVSFDVGDALNLPYKDGTFDLVLTIECIEHVQDKEKFIREMIRVAAPGAPIVILSYAHRNLSPSAESLKPDEKKVLKKICDNLALSCLCSSADFVRWLTQLPAEDIKTADWTQNTSPFFPLLMKETFTWKGFTSLLMKGGWTAIKELLALRMMSKAADDGLLKFVAITCRKSK
Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum)
Class I-like SAM-binding methyltransferase superfamily, gTMT family
A0A075HNX4
Belongs to the Oxygen-dependent FAD-linked oxidoreductase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as fatty acid metabolic process. It exhibits molecular functions including D-arabinono-1,4-lactone...
MAQGAQRKNFGHNQILRPSAAYTPVDEQEVLQILDRHRGQRIRAVGRLHSWSEAVTGDGVLLDLQRLNDVRLQSDGDQLVATVGAGCQIKRLLKELNREGATLHSLGLITAQTIAGAISTGTHGSGRNSMSHYVVGVRLACYDASTGQAIIEELSAGEPLQAARCSLGSLGIILAVRIRCREQYNVQEHFTESRRLLDVMDAEAPFPLQQFYLLPWRWSYFIQHRREDDRPRSRLARLYRLYWLGTMDYGLILQILFLERVARSRRLIRLAFRRIIPAFLIRNWRVTDRSSSMLVMRHDAFRHIEIELFVRRDQLADALG...
Uncultured marine euryarchaeote
Oxygen-dependent FAD-linked oxidoreductase family
A0A075TR27
Belongs to the PatF family. The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It participates in biological processes such as patulin biosynthetic process. It exhibits molecular functions including polyketide synthase activity, oxidoreductase activity. It is...
MKSSLWVSLAVSLIGLGPAAARNDYPGNYPSSSPPLGPTDWERTPVSVFAKVLNTQPDPDYNLLKELVTYDCTYISLTFDNPTLHGIMPWAGTHTHVGPQAFIDIFTRVGLYWDRGPFSIDHIFGDDGNVTAWGSFTATSRTLGKTVISPWAARARVNSANQIFEFQWMEDTFTTASSFGSDNSTKVFIANPEGGTAHA
Penicillium expansum (Blue mold rot fungus)
PatF family
A0A075TRA9
Belongs to the Major facilitator superfamily, TCR/Tet family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as patulin biosynthetic process. It exhibits molecular functions including transmembrane transpor...
MSIDASPSESVLESQTPDRVDESIPIKAEETEKDAAPGRDIVGFRWLLVCIAVFSANLLYGLDNTIVADIQAPIAGDFNEYTRLGWLGVGFTLGSVVFILPLGKAYAIFDTKWLFLGCLTMFAAGSALCGAAPSMNAIIVGRVWAGAGGAGMYLGNLNLITILTTPKEQPVYVGLVGLIYGTGCILGPIIGGAFSDSSATWRWSFYLNLVIFGVMSPIYVFLLPSLPRPAGEGRSFFKKLVELDWVGTVLSAGMHISIILFIVFGGVEWSWTDGRNIALYVVSAVLTIAFVLSQYFCIGTTKQDRLFPGEFLRDPTMLLL...
Penicillium expansum (Blue mold rot fungus)
Major facilitator superfamily, TCR/Tet family
A0A075TRL0
Belongs to the Acetate uptake transporter (AceTr) (TC 2.A.96) family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as patulin biosynthetic process. It exhibits molecular functions including acetate transmembr...
MKLSAEGTVMASSEEAAQLSCDTSSSHARNSKEQDFQPTQQIGSPTALGMGAFAIAFTTLSMSLMEWRSAAITNAYIGNCFFTAGMGLVLVAQWELVRGNSFGHTVFGGFGLFNLAFGAINAPAFGVADAFKDDPAALNNAIGYFLLVWGIFVLFFTVAAMPMNLVYTGMLGTSQITYTLLAASYFSFADDHASAGLALKKAAGAFGFVSGLFAWYTVGHLMCQDALLFSFPLGDTSPLYARLQRKKRH
Penicillium expansum (Blue mold rot fungus)
Acetate uptake transporter (AceTr) (TC 2.A.96) family
A0A075TXZ3
Belongs to the Type-B carboxylesterase/lipase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as antibiotic biosynthetic process, monocarboxylic acid biosynthetic process. It exhibits molecular funct...
MQIINWASLLLVTWETVVAAELPIVDLGYQRHQAIGFNSTGRYYQFSNVRYAEPPLGPLRFSLPVSPRNRSHEVVNGKGLGNICPQSQACWFNVQGDFVSAVTAGSTFNFTAAYDQVYQQDECTKPRPVADQNPLESEDCLFLDVYVPEKVISKRRDGNGKSNPGAPVLVYFQDGAYVSGSKSDQNPSGLIATSREDGSTGIIYVGVNYRLGVFGWLSGQKFQSEGGLPNAGLYDERLALEWVQRHITKFGGDPSRVTVMGVSAGGGSITMQLTAYGRAIRPPFAQIIAQSPAWEPGTKTPAIEDDLLDSFLTLLNVSSL...
Penicillium expansum (Blue mold rot fungus)
Type-B carboxylesterase/lipase family
A0A075TXZ8
The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as positive regulation of transcription from RNA polymerase II promoter by galactose, DNA-templated transcription, positive regulation of patulin biosynthetic ...
MYSTFSANFDTTIDASRDRSATPVTAPRPKRNQVARACDWCRLNRVRCDDKQPCQNCQNRGGSCSNTKPQEATSLPAANREMQRLRNKVKDLQDQIAKLKEGAEIQAQTGFATPPLSDAAHTSFDFAELTNTTEGWQGLQQTGQIHYGPLSSSYFVSRISRYLSQALNEPIEDAKLEACMARFHYIAPSHQPSRWDASPASQADQPQDGTEEAEDLTRSQEEHFLNLLWQSFHCVYPILDEREFQQYYESLWSSSPDGMSTRKPSALVDVLLAVCMQYSSTFFVSDDNQQGDTDSEWQAKHANLASRTYYQRAQRLLQSE...
Penicillium expansum (Blue mold rot fungus)
null
A0A076FF10
The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as flavonoid metabolic process. It exhibits molecular functions including monooxygenase activity, chlorophyllide a oxygenase activity, metal ion binding, 2 iro...
MEVLQASSLSFQLLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESAKRDREGGHELEIRVGKIDVNGFSAKQVSADYYFVPPYLYYGRITPNTATKAIDVTLPVVPE...
Ocimum basilicum (Sweet basil)
null
A0A077EWA5
Belongs to the Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as alkaloid metabolic process, methylation. It ...
MGASIDDYSLVHKNILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSYYEIGLPFIQKAGVEHKINFIESEALPVLDQMLEEMKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY
Narcissus aff. pseudonarcissus MK-2014 (Daffodil)
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
A0A077K8G3
Belongs to the UbiA prenyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It exhibits molecular functions including prenyltransferase activity. It is located in cellular components such as chloroplast, chloroplast membrane.
MLQMHSNSSFSPKCYYPLQHAGCVKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYSTNKIRNNENSSSRNCKPFNKYRVAVTLQQQDCASNNEDDINSTSFRDVLLKKLHALYVFTRPFAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDKVNKPGLPLASGDLSVGTGLAITLILSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLPFLRWKTNPFLAGMCMVIVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVMSLLKDIPDEDGDKQFGYQSIS...
Citrus limon (Lemon) (Citrus medica var. limon)
UbiA prenyltransferase family
A0A077LPS9
Belongs to the N-acylglucosamine 2-epimerase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as carbohydrate metabolic process. It exhibits molecular functions including isomerase activity.
MTLWTARAAHRAWLDAEARRLVDFAAAADHPEHGFAWLDGSGAPLPEQGVHTWITCRVTHVAALAHLEGIPGASALADHGLRALAGPLRDPEHDGWFTALDSRGTVADSRKEAYQHAFVLLAAASATVAGRPGARELLDAAAAVIEQRFWEEETGRCRESWDAAWHADEPYRGANSNMHLVEAFLAAFDATGDRVWAERALRIAHFFVHEVAAPRDWRLPEHFTPDWQVVADYNTDDRAHPFRPYGVTVGHVLEWARLLVHVEAALPDPPSWLLADAEAMFAAAVARGWSVDGTEGFVYTLDYDDTPVVRSRMHWVVAEA...
Thermobifida fusca (Thermomonospora fusca)
N-acylglucosamine 2-epimerase family
A0A077Y877
Belongs to the NRAMP (TC 2.A.55) family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as iron ion transmembrane transport. It exhibits molecular functions including manganese ion transmembrane transporter...
MHQDNSMRRAINQSRNGGSDSCDINNDREHDNINRNSYINNFHIENINSDKNEQSYIYCSDRAQVTDSILGNRKYTHEENINSTEMFSRTNYEYSNKNNVDIEMYNISNNNFYNGNNNGHSNDIIDYINNNNVNKDLSNTSNNADINTYIKKLTSNQSTAYCDGKGYNESANGSNFDINFRDVIKNNNNKNYKNNNHVPDDMLELGDRSFDSSFYIHNNVEEIDTERSNRLSFMSKLKMYFNYFGPGWIVAIAYLDPGNICGNLNVGLIRSDDFINVNSSVKDYTGYRLLWVLVYGHILGFIFHTLSMKLGHITGLDLAA...
Plasmodium yoelii
NRAMP (TC 2.A.55) family
A0A077YBL0
Belongs to the Cyclic nucleotide phosphodiesterase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as signal transduction, cGMP catabolic process. It exhibits molecular functions including metal ion ...
MKHMFKNILFHKKGKHDKNDAIKKAFSLFSVPSNENERIIKFWPLKFKEKDEETLYIIKLCDNMYSKKYVILVSHLISLLLMYSVCLIVGNINDLFSVLKLTYILLHTFTAINIILILTLHATHYVEMFKSIKGEIFIFYIMMIFVIWCSWLFILFNNIKDLLPIVVNVNNFLYATYANNKINIVLGFFAYLPIFYLITIIPCRICYSCAFDILFFIMKVAIFSVYYLITMKSYILTDNIFMIISALVGSLFIFVIRYIIEIQRRLSFHNWNKQTKQIIKLKKTLKEEKQKLSTTNIEEIYNLINDSIGNYYNENKKQKE...
Plasmodium yoelii
Cyclic nucleotide phosphodiesterase family
A0A078BQN7
The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as regulation of transcription by RNA polymerase II, anatomical structure morphogenesis, cell differentiation. It exhibits molecular functions including RNA polymer...
MQSNDENIYFPANQYVNAGQYSPLQQSFSQNSQYDLFDGFAEFGFLEQVPTTNMHSFSQSTQMEQNCLPNVNNSTRKRKAPGQNEQATVKRRQIGIEKWRLPSRSVVQPSADISDLRRPPISYVALCALACRNAPDMKITPAGVYAFILHHWRYYRYANENWKNSVRHQLSSKEHFDEETFQPDPSNQTVRRKFYIVKNPNMIRQNLISDADFDFFRKDSRGIEFYQKMFAGQIGLPRSLFYQIIGNEIPFLAGPENSSMFYQLLGMGKVVGYLETRYFREHYRSEHAATEPKYEEDYANFTEKIPSNAENLMSYGAATE...
Caenorhabditis elegans
null
A0A078BQP2
Belongs to the Adenylyl cyclase class-4/guanylyl cyclase family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as cGMP biosynthetic process, receptor guanylyl cyclase signaling pathway, intracellular signal tr...
MLLLLLLLKISTFVDSFQIGHLEFENSNETRILEICMKNAGSWRDHRLISLPSCHNFNGLENAANLNYQYSVDLLIGAACDEETQTVSRLALRWHKLYLSSAPLSTKEKESTTIALKPHSLAGTAEVILAMCKSMKWKEIGIIYSEETKYTAHAIYDMLAEQEDDLKINVFLETDGLSNTYTILHSARALISFLTTLDLSKFFKTLKENAFRPLEFSIVHVDCNKSEISNFYTYLDNNAGEEPNPISAARLRKLYRHVALLKNSHDDMEKTEEFAKKYGLVPSYTLYKALILCDGLQLLNNYTAPRGNLSIVQQLPYLWN...
Caenorhabditis elegans
Adenylyl cyclase class-4/guanylyl cyclase family
A0A081HJP9
Belongs to the HpcH/HpaI aldolase family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as phenylacetate catabolic process. It exhibits molecular functions including aldehyde-lyase activity, metal ion binding....
MDLPVNRFKQRLRSGEAQIGLWLGLADPYCAELAANAGFDWLLLDGEHAPNDLRSLLGQLQALAPYPGQPVIRPVQGDTALIKQLLDIGAQTLLVPMVDSAAQAEGLVRAVRYPPAGVRGVGSALARASRWNSVAEYLNHADEQMCLLVQVENLEGLANLDAIAAVEGVDGVFIGPADLSAAMGHRGNPGHPEVQAAIEDAIHRIRTAGKAAGILSADETLARRYLELGCAFVAVGVDTSLLMRSLRELAGRFKGGAPAPSASSSVYG
Pseudomonas aeruginosa
HpcH/HpaI aldolase family
A0A084JZF2
Belongs to the Polysaccharide lyase 28 family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It exhibits molecular functions including lyase activity, metal ion binding. It is located in cellular components such as plasma membrane.
MRKLKYNTTRVILMIAFISLSACSSEDAMIEEEQVIPDPDPVAQTDEDTGPVVDCTNQGTNPTRDTDIPNPRNIGDIDDRSCYANYSESSILGKFWGIYNITDGSNHMDAPNTLQPRIERSLSRSQATGAGSYARFRGVLRILEVGDTGTFSSSGSYFMQAKGKHTGGGGSPDPAICLYRAHPVYGDDGNGNQVQVSFDIWREQINFRGGSGSAGRTEVFLKNVLKNEQIDIELEVGFRDDPNNPGQTLHYADAKIGGEEFNWNIPEPERGIESGIRYGAYRVKGGRAQFRWANTSYTKDEVN
Nonlabens ulvanivorans (Persicivirga ulvanivorans)
Polysaccharide lyase 28 family
A0A085GHR3
Belongs to the HopBF1 family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It exhibits molecular functions including ATP binding, kinase activity. It is located in cellular components such as extracellular region, host cell.
MFNVSNNVAPSRYQGPSSTSVTPNAFHDVPSLGQKVGAGSQKDVFHSRQDPRQCICLFRPGTTGSIPAEQYAQKELETTKQLKNLGFPVVDAHALVKHQGSVGVAKDFIHNALDSEDIVNNKKSLPDNLKFNKNVLEDCNAIIRRLKNLEVHIEDLQFLVDHNGHVLINDPRDVVRSSPDKSISKVNELRSHALNNLLDIDSD
Ewingella americana (strain ATCC 33852 / DSM 4580 / CCUG 14506 / JCM 5911 / LMG 7869 / NCTC 12157 / CDC 1468-78)
HopBF1 family
A0A087WNH6
Belongs to the Adenosylhomocysteinase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as one-carbon metabolic process, S-adenosylmethionine cycle, L-homocysteine biosynthetic process. It exhibits molecula...
MNAKPGFTDYIVKDIALADFGRKEISLAETEMPGLMATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTAKLFDWHGGGTPNMILDDGGDATMLVHAGYRAEQGDTAFLDKPGSEEEEIFYALVKRLLKEKPKGWFAEIAKNIKGVSEETTTGVHRLYEMANKGTLLFPAINVNDSVTKSKFDNLYGCRESLVDGIRRGTDVMLSGKVAMVAGFGDVGKGSAASLRQAGCRVMVSEVDPICALQAAMEGYEVVTMEDAAPRADIFVTATGNK...
Bradyrhizobium elkanii
Adenosylhomocysteinase family
A0A087WRI3
Belongs to the CFAP77 family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It participates in biological processes such as flagellated sperm motility. It is located in cellular components such as sperm flagellum, axonemal B tubule inner sheath.
MPDPAKPGKDLTAWKKKKQPVHRTVSQICPPPRRPLTVVDIRTGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLPGINFNYGLYIRGLDGGVPEAIGHWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENMLYRELNDIRINDQEDRRQKEPPPIPPNMTFGIRSRPSTPFFDLLQHRYQQLWVQEQKATQQAIKMEKKQKVILGKLYETRSSQLRKYKPPVKLDALWHMPHFKKVASHLATFPTEADRQRALKAHKEEYAVRQGTLRMGNYTHP
Mus musculus (Mouse)
CFAP77 family
A0A087WRU1
The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as meiotic cell cycle. It exhibits molecular functions including DNA binding, RNA binding. It is located in cellular components such as chromosome.
MNWVGGSRSRVLIKQERRKQKEYFERNKLKSKLKLLGVVSPVKKPSVSLDLLNLYVVNQISSMKENSETMKRPTHVNMTRDLKVPLRKHDLELPMSPHCVPSKLCIDDMEDSVPYQRIYSKEETGPVQSSQDMKSYRMFNETGNCSYIPPSFPEELRSNRHIRSQHSTPRIGPSPQQFVYENPHSGQFSNGKFPESLFSKLNKHQHVFSSSQTTAEFEAPYKRTNSSETGDFLTKRSMIMGEDCRSLYERRQPDFAMEKPLVQQIYANNGEEFSNFLEDVIHPTQRHLPDNHNSFVSHSMIDLLSKDQPGRRATFTKCGY...
Mus musculus (Mouse)
null
A0A087WT01
The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It participates in biological processes such as adaptive immune response, immune response, response to bacterium, defense response to Gram-positive bacterium. It is located in cellular components such as alph...
MVLKFSVSILWIQLAWVSTQLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG
Homo sapiens (Human)
null
A0A087X0K7
The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It participates in biological processes such as adaptive immune response, cell surface receptor signaling pathway. It is located in cellular components such as plasma membrane, T cell receptor complex.
MDIWLLCWVTLCLLAAGHSEPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG
Homo sapiens (Human)
null
A0A088BP94
Belongs to the Neurotoxin 10 (Hwtx-1) family. The protein length falls within the range of 31–100 amino acids, belonging to the category of Small proteins. It exhibits molecular functions including ion channel inhibitor activity, sodium channel regulator activity, toxin activity. It is located in cellular components su...
MKFAIVITLLLVAFSAVALADKSIERAVMDLITARDDDCGKLFADCTSDSDCCENWVCSKTGFVKNICKYNFG
Heteropoda venatoria (Brown huntsman spider) (Aranea venatoria)
Neurotoxin 10 (Hwtx-1) family
A0A088MF62
Belongs to the Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as biosynthetic process, flavonoid biosyntheti...
MALSMDNIVISNEEEIYMMKAMHIPCGLYLNMVLRAAIELDLFEIIAKSTTQKLSSYEIASQIPTKNPNASSLVLERILRFLASQSFLTCNITKNDDGNVHTSYNLTPLSQSLISDKDGSSLAPFLLLHSESVVVNSCFLLKDAILQGEVPFNKAYGMNAFEYTKKDSRMNGLFNKAMQNVTCIEMKKIVECYNGFEGVKETIDVGGGLGISLASIISKYPNIKGINFDLPHVIKDAPTYEGIEHVGGDMLKSVPQGELIILKEILHNWDDEDCVKILKNCWRALPNDGKVVVIEQIQPEYPETNLLSKHLFALDISMMI...
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family
A0A089MMR2
Belongs to the Glycosyl hydrolase 94 family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as carbohydrate metabolic process. It exhibits molecular functions including glycosyltransferase activity, carbohy...
MNRSDAYGYFRNQGREYVITTPRTPARWFNYLFNDTYYTEISQTGQGDSVAFRPHNRTLTRGFRYFYLKDLETGGTWSPLYQPLKTEPEAYECIHSLGTTEIRSVSQEIASSIHVFVPRAGQQEIWTVTLTNTGVKPRSLSLFTAFSLENGGVMGSKCQFDQESQILSSYSFPYHVTYGQKAGCDDHTNVVYVYPDYPADSYDCSQRAFFGGDDIYELPAAVQKGRCSGGQAEAENPLGALQQTITLEPGEQAVRHFVVGCASSLEEIRSSKAELAAKGYAVLLQETEDYWEGITGMFRVETPDDDVNAFMNIWLKKQIV...
Paenibacillus borealis
Glycosyl hydrolase 94 family
A0A095C325
Belongs to the ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as oligopeptide export from mitochondrion. It exhi...
MSASPSPIGAAAGLDHLQARRDEEVVDSEKDALAHDSHAVNSGIPHPTATAPTIGIPIVPISAGRESSAPEEKISRSSIAASSDILHNPPSEKSISSAVPKSHRYKKSKFNFLKSRKKKEEEEKKNKEKEKEASVLPPVSFFALFKFAAPLEIVAMVFGLLLAIAAGSCQPLMTLIFGRLTTSFTNYAVIVNQISQGGLTPETAAALQAAKDDLKTQSGHNALYLMAIGIGMFLATWLYMFIWNVTGELNSKRIRERYLAAVLRQEIAYFDDLGAGEVATRIQTDCHLVQEGTSEKVALVFQYAGTFVCGFVLAFVRSPR...
Cryptococcus deuterogattii (strain R265) (Cryptococcus gattii VGII (strain R265))
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
A0A095CCB2
Belongs to the DAMOX/DASOX family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as D-amino acid catabolic process, detoxification. It exhibits molecular functions including D-amino-acid oxidase activity, FAD b...
MVKYDAIILGSGVLGLSIASELILKGLKVAVVGKDLPEDLDSTGFASPWAGASWRSVAVNEAERRRDHYTFEQFARLAKEVPHLCEKRAYYYFWTCEDAWKEPWYKDLVFGYRMLKPEEVHAPFKYGVTYEAYTLNTPLYLLHLASTLRSAHVPIIRARLSSLDEAYSLPQLGPVDLVINATGLGARSLLGVEDPTVFPAKGQTVLVRAPVKECYGLVDPLPQPSQKAYIIPRPGPDGHVILGGCYLPNDWSTNVDPQVAEEILKQCHTLCPRLDGKGGKGTWKDIEVIAHNTGLRPVREAGLRCELEERVIGGKVRAGL...
Cryptococcus deuterogattii (strain R265) (Cryptococcus gattii VGII (strain R265))
DAMOX/DASOX family
A0A096LP01
Belongs to the SMIM26 family. The protein length falls within the range of 31–100 amino acids, belonging to the category of Small proteins. It exhibits molecular functions including protein kinase binding, transmembrane transporter binding. It is located in cellular components such as mitochondrion, mitochondrial outer...
MYRNEFTAWYRRMSVVYGIGTWSVLGSLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP
Homo sapiens (Human)
SMIM26 family
A0A096X8J7
Belongs to the Anion exchanger (TC 2.A.31) family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as bicarbonate transport, regulation of intracellular pH, transmembrane transport, cardiac muscle cell action po...
MGRSYNEKDFEYHRHTFHHTHHPLSTHLPPQRFRKRVLSMDRRRKRKRKKKKTSMPPSDVTPTIHEVDEEEAESEIEGQCQAATPTEPSEELPQLSLGSEEDLAADLPLSSFHMESERPASSEETLPSPASMEEKEETQQPPDGGEHKDISNSFSPSPEAASMTTRGWFRRKPVHRLAGAQRTSYDLRERICIGSMTAMETAVYQKVPTDEAEAQMLASADLDDMKSHRFEDNPGVRRHLVKKSSRCQLPRSSNGSPPLSSLKRRKRMDKKTHEVFVELNELIVDKNQEMRWKERARWIKFEEDVEEETDRWGKPHVASL...
Danio rerio (Zebrafish) (Brachydanio rerio)
Anion exchanger (TC 2.A.31) family
A0A096XJN4
Belongs to the Glycosyl hydrolase 13 family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as starch catabolic process. It exhibits molecular functions including alpha-amylase activity, calcium ion binding, chl...
MQHLSILLVVLGSSIAFAQHDPHFADGRNTIVHLFGWKWGDIASECENWLRKKGFAGVQISPPSENPIVSGRPWWENYQPVSYDLKNRNGDEDSLSDMIKRCNNVGVRIYADLVVNHMATSIGQGTADHSYDPGSKSYPAVPYSNENFHASCDIDYNDAASIRNCELSGLKDLDQSQDYVRGKIVDYMNHLVSLGVAGFRVDAAKHMWPADLAAIFGSVNDLNTDFFPSGSRAYIYQEVIDTGSDPIDNKDYTGFGSVCEFKYGIQLATCFRGSNPLKYLENWGTGWGLLDGGNTLVFIDNHDTERSSGSYLNYKESRAY...
Hypothenemus hampei (Coffee berry borer)
Glycosyl hydrolase 13 family
A0A098D065
Belongs to the ATG11 family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as autophagosome assembly, autophagy of mitochondrion, protein transport, ribophagy, piecemeal microautophagy of the nucleus, reticulo...
MALQVLIAHTGLRLEVDTAQFSILDDLKTWVSKKTSIPPQHIVALNPHGRTVKITNLHTEKEIFVYDIRISSPGNTNLITPIPLPKRYAVPNAPNTIDDVQSITSWQELYKDRRNWAMRLVEDSGQMSSATLARYSEIDVIIKCLDAAVANLEISIKQIEPKYNDLKKWVAPALEEHGNLVERWEQYLDLAKSTPVSPSMVKFMTGREINKARPTLEDLIELDTAKKAGKLAPTAHRRFSDKANQLGNTASQMYQSLESLIANFETLMSRSALSHSTDSAQLLEDIEAVVKQMDSDYRAALGYGNTQRDVAQASKTASVH...
Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum)
ATG11 family
A0A098D1J7
Belongs to the Cytochrome P450 family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It exhibits molecular functions including monooxygenase activity, iron ion binding, oxidoreductase activity, acting on paired donors, with incorporation or reduction...
MLLIIVVLVGTLIYFLSFHNKKRHGLPPGPKPLPIIGNIKDMPPKGVAAFRHWLKHKDTYGPVSSVSVLGQPLILIHDREAAHYLFDKSSGKSSGRPSANFGGRLCGFDQILSLQQYGDTFKRHRKLVHRQMGTRAGAAKFRQIQDVESHRFLLRSLDNPGNLMEHIRKEAGGVILKATYGYSIEPHKPDPLVHLVEFMVEGISIVVVPMKFVVDFLPWLEYIPECLPGMSFKARARRWRTILNNTIEAPYQFVRQQMAKGIQFESYVSSLLTQEKLKGGNDTLDETYEADIKRTAAIMYAGGADTTVSTIQSFVLAMMV...
Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum)
Cytochrome P450 family
A0A098DRK7
Belongs to the Peptidase C54 family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as autophagosome assembly, mitophagy, protein transport, protein processing, piecemeal microautophagy of the nucleus, aggrephag...
MERAMANVDLGPYRRIVQIFWDPEPTNDVVHDQPVWCLGRSYRLNGKKNIKADDHHPQTPPSVLKAETETQEAHDTAQPPNPPTNAPDTPPDSISSSFSSSLAYDDPVVDGGWPSGFISDFESKIWMTYRSEFEPIPRSTNPQATSALSLSMRLKSQLGDQSPFSSDSGWGCMIRSGQSMLANTIAMVRLGRGDWRRGESVEEECRLLKDFADDPRAPYSIHSFVRHGASACGKYPGEWFGPSATARCIQALTNSHESSIRVYSTGDGPDVYEDEFMQIAKPPGEDFHPTLVLVGTRLGIDKITPVYWEALIAALQMPQS...
Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum)
Peptidase C54 family
A0A098DRQ4
Belongs to the Sorting nexin family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as autophagy, protein transport, retrograde transport, endosome to Golgi. It exhibits molecular functions including phosph...
MWNDEDNNPYGTSFDRRDSQSSSINPTSPSTREYQRFEPPQTPTSDSDNEHNHGVIHDDSDDDDEDLTQDAGPKRKPGGYDSRIEQILYENPKLSILITDAGKSIESGGRYIVYTIKTGDLEVRRRYSEFASLRDALTRLHPTLIVPPIPEKHTMADYAANPTNAKQDQQIIDLRKRMLAVFLNRCRRMEEIRTDGVWWRFFDPNASWSEVLHSHPVASIPKSILKAPPLNPANPTPAHNYLPIPAASAKLKTVAGTNHDNSSGHIQAGPHAFGRFPPEGHNLGEQELDPYFISYESSIKDLEQLLTGPMEKVNRRTLSH...
Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum)
Sorting nexin family
A0A0A0RM07
The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as fatty acid biosynthetic process, secondary metabolite biosynthetic process. It exhibits molecular functions including fatty acid synthase activity, 3-oxoacyl-[a...
MATPDDPATPALSLSASNSSSPTAASSVPPPTGTSEIQYDDVAIIGMSCRTAGGNDSPEKLWRFIMDKKDASGESPSWRWEPWVRRDTRNAKVIEKTISKGYFIEDLENFDASFFGISPKEAEQMDPHQRLGLEVTWEALEDAGINPQSLSGSDTAVYVGVDSDDYSRLLLEDIPNIEAWMGIGTTAHGIPNRISYHLDLMGPSAAVDAACASSMVAVHTGRQAILAGESRIAIVGGVNVCLSPALFHMLGAAGALSPDGVCLSFDEEARGYARGEGAAILILKKMSHAIMDGDHILATIKGSAIAQDGKTNGIMAPNAK...
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
null
A0A0A0VBX4
Belongs to the Conotoxin D superfamily. The protein length falls within the range of 31–100 amino acids, belonging to the category of Small proteins. It exhibits molecular functions including acetylcholine receptor inhibitor activity, toxin activity. It is located in cellular components such as extracellular region, ho...
MPKQEKMMLVLLILPLPYCNAAGVTTVQWGGHGDGLDRYLQRGVRDVHRPCQSVRPGRVWGKCCLTRLCSTMCCARADCTCVYHTWRGHGCSCVM
Conus generalis (General cone)
Conotoxin D superfamily
A0A0A1H7N4
Belongs to the UDP-glycosyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It exhibits molecular functions including UDP-glucosyltransferase activity, 2-hydroxyflavanone C-glucosyltransferase activity.
MMGDLTTSFPATTLTTNEQPHVVVCSGAGMGHLIPFLNLASTLSSAPYRCKVTLLIVIPLITDAESHHISSFFSSHPTIHRLDFHVNLPAPKPNVDPFFLRYKSISDSAHRLPVHLSTLAPPISAVFSDFLFTQGLNTTLPHLPNYTFTTTSARFFTLMSYVPHLAKSSSSSPVEIPGLEPFPTDNIPPPFFNPDHIFTSFTISNANYLSLSKGIIVNTFDSFEPETLSALNSGDSLPDLPPVIPIGPLNELEHNKQEELLPWLDQQPEKSVLYVSFGNRTAMSSDQILELGMGLERSDCRFIWVVKTSKIDKDDKSELR...
Fagopyrum esculentum (Common buckwheat) (Polygonum fagopyrum)
UDP-glycosyltransferase family
A0A0A2J1Z6
Belongs to the Cytochrome P450 family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as mycotoxin biosynthetic process. It exhibits molecular functions including NADPH-hemoprotein reductase activity, iron ion ...
MKDMESIPGPKPLPVVGNLFDIDLENGLQSIIKMAHEFGPLFQITINGQKQIFATSQALVDELCDETRFHKAVMGGIQKLRMLAKDGLFTAYHGERGWGIAHRILMPAFGPLRIRDMFEDMSDVAQQLCFKWARQGSSTSINICDDFTRLTLDTIALCTMGFRLNSYYNSNALHPFIESMLYVLKEAELQSTLPGVANCMRVKAQRRMSKHIDAMRSMARNLIEERRAKPEPVDDLLNTLLNGRDPITGEGMSDDLIISNIITFLIAGHETTSGLLSFTFYYLLQNQDVLERARNEVDEVTGVGPITVQHLAKLPYIDAI...
Penicillium expansum (Blue mold rot fungus)
Cytochrome P450 family
A0A0A2JC26
Belongs to the GMC oxidoreductase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as secondary metabolite biosynthetic process. It exhibits molecular functions including oxidoreductase activity, acti...
MKSIILSCFVISAAASQSYLPTEQIDVQSSLLSDPNHVAGKTVDYMIAGGGLTGLTIAAKLTENPNINVLVIENGFYESSEGEIIEDLNDYGDIFGTTVDHAYEIVSQAINNRTENIRSGNGLGGSTLTNGGSWTRPHKAQIDSWEKVFGNKDWNWDNLFPYMQKAEIARPPNDVEIAAGHFYNSSCHGTNGTVHAGPRNNGEPYSPIIETLMDSAKERGVPTQLDFHCGVPRGISMIPNALHEDQVRSDAAREWLLPNYKRPNLQVLTGQFVGKVLINQTATSGAIPGYKAVGVNFGTNKNVNSNVYAKHEVLLASGSA...
Penicillium expansum (Blue mold rot fungus)
GMC oxidoreductase family
A0A0A2JP37
Belongs to the Glycosyl hydrolase 18 family, Chitinase class V subfamily. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It participates in biological processes such as polysaccharide catabolic process, chitin catabolic process. It exhibits molecular func...
MAPLWNGMAAGLLLSAAVVSGQANSRLGASPSYQGFSNICPEQCIVTGPEPSNWSTYNDMNRLANCNQAMLYGFNLYDDVDDADSYHRIFACTAYGNDWSDDSQSHVTNSRPEKEHKVNYEIGWSSYSPGTESDYRSLIRQMRDYVARGHISPSKTAMLYAQFGYTSAGIYIGNSLQSKDIGDVALQSLIDDSHDFDGRRDSLTMQLCGPHYDSQHVFGFMALRNGTFRAIQSAFKSWSNAECLDFEHSTNFTASTHFTSSMLSSIKAGNTTTSGIQAGGSALPAKLSTQHTKNLMSSTGECRTQKVQNGDSCAAIATRC...
Penicillium expansum (Blue mold rot fungus)
Glycosyl hydrolase 18 family, Chitinase class V subfamily
A0A0A2K2F6
Belongs to the GMC oxidoreductase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as secondary metabolite biosynthetic process. It exhibits molecular functions including oxidoreductase activity, acti...
MKLLGLLSGLVVVATALPQADFDLQSSLLTDPTKVAGTTFDYIIAGGGLTGLTVAARLTENPNITVLVIERGFYESNIGPIIENLNHYGDIFGTSVDQAFETIPLAIHNRTEIVRSGKGLGGSTLVNGGSWTRPHKAQVDSWESVFGMEGWNWDSLLPYMKKIEAARAPNAEQIAAGHYYDPSCHGTDGIVHVGPRDTGESFSPMIKSLMKNANNSGIPVQKDLGCGVPHGISMILNDVHEDQTRSDAAREWLLPNYQRSNLKILTGQMVGKVLFDTTTTTPKAVGVNFGTHAKVNFDVHARHEVLLASGSAVSPQILEH...
Penicillium expansum (Blue mold rot fungus)
GMC oxidoreductase family
A0A0A6YY25
The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as male meiosis I, spermatogenesis, transposable element silencing, cell differentiation, positive regulation of transcription elongation by RNA polymerase II,...
MCSPASSKILYRNPRFLRVAFLQLHHQQQSGVFCDALLQAEGEAVPAHCCILSACSPFFTERLERERPVQGRKVVLEMGGLKIQTLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRVSELETLQLEGGKLVKAPQGRRLNRECLQPPAAAPISARVVGPKSRPQTPLPVTQTPSPLGAVRLKSLGEEEGAHKKTNLPNADSLSDTQLKKKARVCLTQESRSSPSSQREGPKETKSNPGPTALPSLYPSVDEQLLPRKIRLSRSKPSPHVYTSTPSSILSGPSSMPTAPGRRLWRQRTVSKEAQGVDKQKPGEVRPLQSTP...
Mus musculus (Mouse)
null
A0A0A6ZFR4
Belongs to the UDP-glycosyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as response to molecule of fungal origin, terpenoid biosynthetic process, saponin biosynthetic process, terpene biosy...
MLSKTHIMFIPFPAQGHMSPMMQFAKRLAWKGVRITIVLPAQIRDSMQITNSLINTECISFDFDKDDGMPYSMQAYMGVVKLKVTNKLSDLLEKQKTNGYPVNLLVVDSLYPSRVEMCHQLGVKGAPFFTHSCAVGAIYYNAHLGKLKIPPEEGLTSVSLPSIPLLGRDDLPIIRTGTFPDLFEHLGNQFSDLDKADWIFFNTFDKLENEEAKWLSSQWPITSIGPLIPSMYLDKQLPNDKGNGINLYKADVGSCIKWLDAKDPGSVVYASFGSVKHNFGDDYMDEVAWGLLHSKYNFIWVVIEPERTKLSSDFLAEAEE...
Panax ginseng (Korean ginseng)
UDP-glycosyltransferase family
A0A0A7HFE6
Belongs to the CRISPR-associated Csm6 family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as defense response to virus. It exhibits molecular functions including nucleotide binding, RNA binding, endonuclease ...
MRVLISAVGDTDPFRNFHDGSLIHIARKYRPEKVILIFSEHTAKKQGNIEKALFSIAPNYEPELIIHDPIISDNEVHIFDVMFQRFSDILQEYYTKEDEFILNLSSATPQIKSALFVINRLNGINVKAVQVSSPEHASNENIGHDNDENIDELIEVNKDNKVNFIDRTIEDNAEKFSQALLKKTARDFIEKFDYKAALDILDQLSDFPNLKSVREEIRDVVNCLSKQDVPKGLRHKKLKEEEQKILSAYLTIELQRERGNVSESFIRIKNLTEFILEDYIEKRYPGLIDEYCEDIQKYYLSLFDYSKLLKATKEFKLKRT...
Streptococcus thermophilus
CRISPR-associated Csm6 family
A0A0A7LRQ7
Belongs to the Peptidase S12 family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as effector-mediated suppression of host defense response. It exhibits molecular functions including serine-type endopepti...
MYTSRLLLSNLASCLSLATLVASFPANQQDLTFAKRNGTFEQSVFYGLTGPEVEAKLAKLKADGYRPTSLNIHGSTSDAKYAGIWTKQTGDDFETILGANKTVYDAWLDSHKAQGYVSTHVSATGGSSDALFAGVMEKVPSVANWIQVCGLDNPYAYANATIDEPMYIKGVSMYGAPNERQYCILGHENLVNYQQTVFYQTDYFKKDYAKLLQSETSKRHWRPVFIDLSEDLLPTPIFDDTSVGQWVARTDLSASELEAEIAAQKAKNLYAVHIAGAGSKGSKYAVLFAEHLSPLERKWTVTGEVTGFKTNDVVAKDMDA...
Epicoccum sorghinum (Endophyte fungus) (Phoma sorghina)
Peptidase S12 family
A0A0A8X0K1
Belongs to the Prokaryotic molybdopterin-containing oxidoreductase family. The protein length falls within the range of 801–2000 amino acids, belonging to the category of Giant proteins. It exhibits molecular functions including oxidoreductase activity, molybdopterin cofactor binding, metal ion binding, 4 iron, 4 sulfu...
MENQHQKFISRRNFIKTSALLGGTAFLGTGLPNIKKTYSKELDYVGNFEYPLAKPENILYSACLQCTVACSIKVKINNGVCMKIDGNPYSAMNLGENLPYDLSPKEAVSIDGKLCPKGQAGIQHAYDPYRLRKVIKRDGPRGSGKWKTIPYDQAIDEIVNGGNIFKDIGENQNVEGLKDIFVLKDPKVAKAMADDVTKIRKKEMTVDEFKAKHKDNLDVLIDPNHPDLGPKNNQFLFQVGRIHNGRIEFTKRFVNDSFGSVNWIEKTTLCGQTSNKAWVHSTREYLEGKWTGGIKSPRPDHRNTEFLLVFGSIVFEANYG...
Mesobacillus selenatarsenatis (strain DSM 18680 / JCM 14380 / FERM P-15431 / SF-1)
Prokaryotic molybdopterin-containing oxidoreductase family
A0A0B0QJN8
Belongs to the MntA antitoxin family. The protein length falls within the range of 101–200 amino acids, belonging to the category of Medium proteins. It exhibits molecular functions including ATP binding, nucleotidyltransferase activity, metal ion binding.
MQDKIPTIAELRELSLRLLTKIPYLKMLVLFGSRATGNINANSDWDFAVLYDEEKYNLYIQNNPLAAFVIPGILGEIFKINSDKIDIVELNHCSKLIAHFVARDGKVLYEEPGDEFDKFQQRVLLSNTEIKKIEKTKLENIENFLQRWGV
Aphanizomenon flos-aquae (strain 2012/KM1/D3)
MntA antitoxin family
A0A0B0SG80
Belongs to the DarT ADP-ribosyltransferase family. The protein length falls within the range of 201–300 amino acids, belonging to the category of Typical enzymes. It exhibits molecular functions including DNA binding, glycosyltransferase activity, nucleotidyltransferase activity.
MKRTYPEPTPIYHITHIDNLKGILRMGKLLAHNQSPPKQRSIAYAHIQERRNRAKVPQPPGGVLHDYVPFYFCPRSPMLYAIYSGATEYQGGQEPILHLVSSAQAVHKAGLPFVFTDRHGVLSHARFFRQLEELAQLDWEAIQASYWADPPELREKKQAEFLVYKAFPWALIEEIAVYSQRVGEEVLKILKQFPEARRPRVCIRKDWYY
Thermus sp. (strain 2.9)
DarT ADP-ribosyltransferase family
A0A0B4F1I0
Belongs to the Multicopper oxidase family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It exhibits molecular functions including copper ion binding, oxidoreductase activity. It is located in cellular components such as cell surface.
MSRFARLLLIVALFFTSAWAKTVKETLRITWEEGAPNGQARELIYTNGQFPSPTLVWDEDDDIEVTVYNEMAKNVTVHWHGLDQKDTPWSDGTPGLSQRPIQPGNKFVYRFKASPPGNHWYHSHEKMSLVDGLYGAIHIRPKGDRTGLWSQISQDKDDIKAMENAAYDPEYLVVSDWSQYTSEEYWKISTDSGLLVFCLDSILVNGKGEVYCPGQKFLQAELAPGLVEDAFPPGTEVSDKGCFPADLDQVQGGPWNITKRPDLIPPRVQEGCVASRHENATIVVDPSKNNGWVSMHFVAAATIAQITFSVDSHEFWLYEI...
Metarhizium anisopliae (strain ARSEF 549)
Multicopper oxidase family
A0A0B4K753
The protein length falls within the range of 31–100 amino acids, belonging to the category of Small proteins. It participates in biological processes such as phagocytosis, positive regulation of phagocytosis, positive regulation of defense response to bacterium, positive regulation of endosome organization. It is locat...
MDCFKVFEVVFQSEINPLLLIPAVATIALTLCCYCYHGYQWIRDRRTARIEEQQAQLPLPLSRISITPGCSMVATTKLTHSRNSVDIY
Drosophila melanogaster (Fruit fly)
null
A0A0B4ZTQ2
Belongs to the UbiA prenyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It exhibits molecular functions including transferase activity, transferring alkyl or aryl (other than methyl) groups. It is located in cellular components such as...
MELSSACNLSLKPNYYYYPTSLFPSNNSYNNLKASSYYQTQRPIKCCSYSPSKYCSTKKLQTTHLLGLYAKHKCLKPFSIGHLPRPNSLTAWSHQSEFPSTIVTKGSNFGHASWKFVRPIPFVAVSIICTSLFGAELLKNPNLFSWQLMFDAFQGLVVILLYHIYINGLNQIYDLESDRINKPDLPLAAEEMSVKSAWFLTIFSAVASLLLMIKLKCGLFLTCMYCCYLVIGAMYSVPPFRWKMNTFTSTLWNFSEIGIGINFLINYASRATLGLPFQWRPPFTFIIGFVSTLSIILSILKDVPDVEGDKKVGMSTLPVI...
Humulus lupulus (European hop)
UbiA prenyltransferase family
A0A0B5GR44
Belongs to the Glycosyltransferase GT106 family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as fucose metabolic process, cell wall organization. It exhibits molecular functions including glycosyltransfe...
MALPKNGGNSSSTKKKVSYISVPSQIINSLSSSSLQSLLVSPKKSSRCTNRFSYRNPRIWFLTLFLVSLFGMLKLGLNVDPISLPFSRYPCSTGSFDEHHAVSHLAFASKNDTQSSSSSEHRKNETLPTEGDFWKQPDGLGFKPCLGFSRQYRKDSNSILKNRWKYLLVVVAGGMNQQRNQIVDAVIMARILGASLVVPVLQVNVIWGDESEFADIFDLEHFKNVLADDVHIVSSLPSTHVMTRPAEEKRTPLHASPQWIRAHYLKRINRERVLLLRGLDSRLSNDLPSDLQKLRCKVASQALRFSPRILELGNKLASRM...
Brassica napus (Rape)
Glycosyltransferase GT106 family
A0A0B5L585
Belongs to the IMPDH/GMPR family. The protein length falls within the range of 501–800 amino acids, belonging to the category of Very large proteins. It participates in biological processes such as GMP biosynthetic process, GTP biosynthetic process, self-resistance to endogenously produced metabolite. It exhibits molec...
MVEILDYTKALEVLKEYPSGDGLHVDTLLDSDNHGALTYNDFLILPGSITFSAADVSLDTKVTRRFTIKAPLLSSPMDTVTEHNMAIHMALLGGLGVIHNNCPPDDQAEMVRKVKRYENGFILDPVVLSPSTTVAEAKELKTKWNFGGFPVTGKTHYLSSFGKLASSDSFSLLEKGTLHSKLLGIVTSRDIQFHKTPEDPVTAVMSTELVTAPAGTTLAEANEVLRSSKKGKLPIVDKDGLLVSLLSRSDLMKNIHYPLASKLPSKQLLCAAAISTHDADKVRLQKLVDAGLDIVVVDSSQGNSMYQIAMIKWIKSTFPD...
Penicillium brevicompactum
IMPDH/GMPR family
A0A0B5L778
Belongs to the UbiA prenyltransferase family. The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins. It participates in biological processes such as terpenoid biosynthetic process, mycophenolic acid biosynthetic process. It exhibits molecular functions including p...
MTNAVEDSGPRDLLFLLISTSRFNRYMPYYTMMAAVWATFIAGALKLQQDPESLSIEFILYKAGLCFVHCLLLCGAGNTWNDLVDRDIDARVARTKMRPLASGKVTLTEALLWMTGQYFLSVKMLDLILDGRNIWTLMLPLTASIMLYPYLKRPIFSKVFVYPQYILGLAIGYPAITGWASITGSEEPLGDIIKHCIPICLLVFFWCVYFNTAYSHQDSVDDRKMNINSAYVIAGQRIRLFLAFLSVLPLLTIPYIISTINSPWLWVSWMATWTVSIVMQIAQFDSQKLESGGRIHWDNFLLGLWTIVACMVEVGLQKVE...
Penicillium brevicompactum
UbiA prenyltransferase family
End of preview. Expand in Data Studio

NL2Protein Dataset

I. Dataset Introduction

This dataset provides aligned pairs of natural language descriptions and protein sequences, where the descriptions integrate protein family information, length constraints, and Gene Ontology–based functional relations. The dataset is intended for studying natural language–guided protein sequence generation and the semantic alignment between textual protein descriptions and sequence space.

The data in this dataset are derived from the UniProt database. Protein sequences, organism information, protein family annotations, and associated GO terms were downloaded from UniProt and subsequently integrated, filtered, and reformatted into a unified text–sequence paired dataset for research use.

Each entry includes:

  • A protein identifier
  • A structured functional description
  • A full-length amino acid sequence
  • The source organism (species)
  • A protein family annotation

The functional description contains:

  • Protein family
  • Protein length range and size category
  • Biological processes
  • Molecular functions
  • Cellular components
  • Parent–child (is_a) relationships between GO terms
  • Cross-ontology relationships, such as:
    • part_of
    • occurs_in
    • regulates / positively_regulates / negatively_regulates

This dataset is designed for natural language–to–protein sequence generation. Given a natural language description that specifies functional, and biological constraints—such as protein family, length range, Gene Ontology (GO) terms from the Biological Process, Molecular Function, and Cellular Component namespaces, as well as their parent–child and cross-ontology relationships—the task is to directly generate a full-length amino acid sequence that is consistent with the provided description. The dataset enables training and evaluation of protein language models on text-conditioned sequence generation, supporting research in controllable protein design and semantic alignment between natural language descriptions and protein sequence space.

Ⅱ. Data Structure

Each sample consists of the following fields:

  • ID: Protein identifier (UniProt-style accession)
  • protein: Amino acid sequence
  • Text: Functional description text
  • species: Source organism of the protein (UniProt Organism field)
  • family: Protein family annotation derived from UniProt
ID Text Protein Species Family
A0A017SPL2 Belongs to the Tryptophan dimethylallyltransferase family.
The protein length falls within the range of 301–500 amino acids, belonging to the category of Large proteins.
It participates in biological processes such as alkaloid metabolic process.
It exhibits molecular functions including prenyltransferase activity.
MQPYHTLSRVLPFPDANQKAWWDKLGPMLLKAMQS
QGYDTEAQYAQLGMVYKCVLPYLGEFPTVENDATRWK
SFLCPYGIPIEPSLNISQGILRYAFEPIGPDVGTEKDPQN
MN
Accumulibacter regalis Tryptophan dimethylallyltransferase family

Ⅲ. Dataset Loading

from datasets import load_dataset
dataset = load_dataset(
    "csv",
    data_files="NL2Protein.csv"
)
print(dataset)
print(dataset["train"][0])

BibTeX

Downloads last month
14